PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G33700.1
Common NameLOC102700721
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 234aa    MW: 25387.7 Da    PI: 9.5453
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G33700.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.8e-18103157256
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   rk+ ++tkeq++ Le+ F+ ++ +s++++ eLA++l+L+ rqV vWFqNrRa+ k
  OB06G33700.1 103 RKKLQLTKEQTTLLEDSFRVHNILSHAQKHELARQLKLKPRQVEVWFQNRRARTK 157
                   778899***********************************************98 PP

2HD-ZIP_I/II116.41.6e-37103191190
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                   +kk++l+keq +lLE+sF+ ++ L++ +K+elar+L+l+prqv+vWFqnrRARtk+kq+E+d+e Lkr++++l++en+rL++e  eL+ +
  OB06G33700.1 103 RKKLQLTKEQTTLLEDSFRVHNILSHAQKHELARQLKLKPRQVEVWFQNRRARTKLKQTEVDCELLKRCCESLTDENQRLKHELMELQ-R 191
                   69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.8E-1985160IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-1990158IPR009057Homeodomain-like
PROSITE profilePS5007117.23299159IPR001356Homeobox domain
SMARTSM003899.4E-14101163IPR001356Homeobox domain
PfamPF000469.8E-16103157IPR001356Homeobox domain
CDDcd000861.32E-12103160No hitNo description
PROSITE patternPS000270134157IPR017970Homeobox, conserved site
PfamPF021831.7E-9159190IPR003106Leucine zipper, homeobox-associated
SMARTSM003406.6E-17159202IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MLYSSSSMEG EDLGAWLGLG IGGGCAYGGD RSPVQLFSQH VKEETTARGC ERASGSRLKG  60
EKGARLRMVM RNGGDGSRSR GGLSLSDGGG SGSGSGSDGG GTRKKLQLTK EQTTLLEDSF  120
RVHNILSHAQ KHELARQLKL KPRQVEVWFQ NRRARTKLKQ TEVDCELLKR CCESLTDENQ  180
RLKHELMELQ RLASAAAAAG SQLYVQFPRA AMVNVCPSCE KVTEMAKSSS SYSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151159RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126142e-55CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657290.21e-171PREDICTED: homeobox-leucine zipper protein HOX18-like
SwissprotQ5Z6F65e-93HOX18_ORYSJ; Homeobox-leucine zipper protein HOX18
TrEMBLJ3MH761e-171J3MH76_ORYBR; Uncharacterized protein
STRINGOB06G33700.11e-170(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81303448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-38homeobox from Arabidopsis thaliana